PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g47590.1.p
Common NameBRADI_2g47590, LOC100834497
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 284aa    MW: 31346.8 Da    PI: 6.0408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g47590.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Bradi2g47590.1.p 16 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 63
                      678*******************************************97 PP

2Myb_DNA-binding48.12.7e-1569113147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Bradi2g47590.1.p  69 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 113
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8431163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-231166IPR009057Homeodomain-like
SuperFamilySSF466891.03E-2814110IPR009057Homeodomain-like
SMARTSM007172.2E-121565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
CDDcd001671.54E-111963No hitNo description
PROSITE profilePS5129424.51764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2567118IPR009057Homeodomain-like
SMARTSM007172.2E-1468116IPR001005SANT/Myb domain
PfamPF002491.2E-1369113IPR001005SANT/Myb domain
CDDcd001673.30E-1071111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRHAGTGGV QQKLRKGLWS PEEDEKLYNH IIRYGVGCWS SVPKLAGLQR CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDAI VGLHEILGNR WSQIASHLPG RTDNEIKNFW NSCLKKKLRQ  120
RGIDPSTHKP ISSAAAAVET DQAPKDQKPQ TAVEGFSTLK QQQVFDPFPV TDTFNGGFDG  180
VGMTLYDNLG GKDASGFVDY SSVLDVSENL GYGESSSNSS NWNCAPEVNN VLEGHWASES  240
KAEPFAGYGG GEQDEALEHK FVLPCQGGQE HSMAHFDFNL EYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141185108B-MYB
1h8a_C4e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569634.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-110MYB3_HORVU; Myb-related protein Hv33
TrEMBLI1HQR20.0I1HQR2_BRADI; Uncharacterized protein
STRINGBRADI2G47590.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-75myb domain protein 86